Apolipoprotein H (APOH) (NM_000042) Human Mass Spec Standard
CAT#: PH305017
APOH MS Standard C13 and N15-labeled recombinant protein (NP_000033)
View other "Apolipoprotein H" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | APOH MS Standard C13 and N15-labeled recombinant protein (NP_000033) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205017 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC205017 protein sequence
Red=Cloning site Green=Tags(s) MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTG LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPI ICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSR PDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERV KIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000033 |
RefSeq Size | 1216 |
RefSeq ORF | 1035 |
Synonyms | B2G1; B2GP1; BG |
Locus ID | 350 |
Cytogenetics | 17q24.2 |
Summary | Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome (APS). The anti-beta (2) glycoprotein I antibodies from APS patients, mediate inhibition of activated protein C which has anticoagulant properties. Because beta-2-GPI is the main autoantigen in patients with APS, the disruption of this pathway by autoantibodies may be an important mechanism for thrombosis in patients with APS.[provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424960 | APOH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424960 | Transient overexpression lysate of apolipoprotein H (beta-2-glycoprotein I) (APOH) |
CNY 3080.00 |
|
TP305017 | Recombinant protein of human apolipoprotein H (beta-2-glycoprotein I) (APOH), 20 µg |
CNY 2900.00 |
|
TP701230 | Purified recombinant protein of Human apolipoprotein H (beta-2-glycoprotein I) (APOH) domain 1, Gly20-Cys84, with C-terminal His tag, expressed in HEK293 cells, 50ug |
CNY 7820.00 |
|
TP701231 | Purified recombinant protein of Human apolipoprotein H (beta-2-glycoprotein I) (APOH), Gly20-End, with C-terminal His tag, expressed in HEK293 cells, 50ug |
CNY 7820.00 |
|
TP720364 | Recombinant protein of human apolipoprotein H (beta-2-glycoprotein I) (APOH) |
CNY 1800.00 |
其它Apolipoprotein H产品