SSB (NM_003142) Human Mass Spec Standard
CAT#: PH305013
SSB MS Standard C13 and N15-labeled recombinant protein (NP_003133)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SSB MS Standard C13 and N15-labeled recombinant protein (NP_003133) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205013 |
| Predicted MW | 46.8 kDa |
| Protein Sequence |
>RC205013 protein sequence
Red=Cloning site Green=Tags(s) MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVE ALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNI QMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQE QEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAK EALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGS GKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003133 |
| RefSeq Size | 1719 |
| RefSeq ORF | 1224 |
| Synonyms | La; La/SSB; LARP3 |
| Locus ID | 6741 |
| Cytogenetics | 2q31.1 |
| Summary | The protein encoded by this gene is involved in diverse aspects of RNA metabolism, including binding and protecting poly(U) termini of nascent RNA polymerase III transcripts from exonuclease digestion, processing 5' and 3' ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. Autoantibodies reacting with this protein are found in the sera of patients with Sjogren syndrome and systemic lupus erythematosus. Alternative promoter usage results in two different transcript variants which encode the same protein. [provided by RefSeq, Jun 2014] |
| Protein Families | Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401091 | SSB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401091 | Transient overexpression lysate of Sjogren syndrome antigen B (autoantigen La) (SSB) |
CNY 3080.00 |
|
| TP305013 | Recombinant protein of human Sjogren syndrome antigen B (autoantigen La) (SSB), 20 µg |
CNY 2900.00 |


