TWIST2 (NM_057179) Human Mass Spec Standard
CAT#: PH305006
TWIST2 MS Standard C13 and N15-labeled recombinant protein (NP_476527)
View other "TWIST2" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | TWIST2 MS Standard C13 and N15-labeled recombinant protein (NP_476527) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC205006 | 
| Predicted MW | 18.1 kDa | 
| Protein Sequence | 
                 >RC205006 protein sequence 
Red=Cloning site Green=Tags(s) MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER LSYAFSVWRMEGAWSMSASH myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_476527 | 
| RefSeq Size | 1186 | 
| RefSeq ORF | 480 | 
| Synonyms | AMS; BBRSAY; bHLHa39; DERMO1; FFDD3; SETLSS | 
| Locus ID | 117581 | 
| Cytogenetics | 2q37.3 | 
| Summary | The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found. [provided by RefSeq, Apr 2014] | 
| Protein Families | Druggable Genome, Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403298 | TWIST2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY403298 | Transient overexpression lysate of twist homolog 2 (Drosophila) (TWIST2) | 
                                                     CNY 3080.00  | 
                                            |
| TP305006 | Recombinant protein of human twist homolog 2 (Drosophila) (TWIST2), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
