CLPS (NM_001832) Human Mass Spec Standard
CAT#: PH305004
CLPS MS Standard C13 and N15-labeled recombinant protein (NP_001823)
View other "CLPS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CLPS MS Standard C13 and N15-labeled recombinant protein (NP_001823) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205004 |
| Predicted MW | 12 kDa |
| Protein Sequence |
>RC205004 protein sequence
Red=Cloning site Green=Tags(s) MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKT LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001823 |
| RefSeq Size | 578 |
| RefSeq ORF | 336 |
| Locus ID | 1208 |
| Cytogenetics | 6p21.31 |
| Summary | The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419722 | CLPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419722 | Transient overexpression lysate of colipase, pancreatic (CLPS) |
CNY 3080.00 |
|
| TP305004 | Recombinant protein of human colipase, pancreatic (CLPS), 20 µg |
CNY 2900.00 |
