DPY30 (NM_032574) Human Mass Spec Standard
CAT#: PH304981
DPY30 MS Standard C13 and N15-labeled recombinant protein (NP_115963)
View other "DPY30" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DPY30 MS Standard C13 and N15-labeled recombinant protein (NP_115963) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204981 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC204981 protein sequence
Red=Cloning site Green=Tags(s) MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLA VLAKERPPNPIEFLASYLLKNKAQFEDRN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115963 |
RefSeq Size | 800 |
RefSeq ORF | 297 |
Synonyms | Cps25; HDPY-30; Saf19 |
Locus ID | 84661 |
Cytogenetics | 2p22.3 |
Summary | This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenitor cells. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410030 | DPY30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410030 | Transient overexpression lysate of dpy-30 homolog (C. elegans) (DPY30) |
CNY 3080.00 |
|
TP304981 | Recombinant protein of human dpy-30 homolog (C. elegans) (DPY30), 20 µg |
CNY 2900.00 |