DPY30 (NM_032574) Human Mass Spec Standard
CAT#: PH304981
DPY30 MS Standard C13 and N15-labeled recombinant protein (NP_115963)
View other "DPY30" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DPY30 MS Standard C13 and N15-labeled recombinant protein (NP_115963) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204981 |
| Predicted MW | 11.2 kDa |
| Protein Sequence |
>RC204981 protein sequence
Red=Cloning site Green=Tags(s) MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLA VLAKERPPNPIEFLASYLLKNKAQFEDRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115963 |
| RefSeq Size | 800 |
| RefSeq ORF | 297 |
| Synonyms | Cps25; HDPY-30; Saf19 |
| Locus ID | 84661 |
| Cytogenetics | 2p22.3 |
| Summary | This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenitor cells. [provided by RefSeq, Mar 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410030 | DPY30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410030 | Transient overexpression lysate of dpy-30 homolog (C. elegans) (DPY30) |
CNY 3080.00 |
|
| TP304981 | Recombinant protein of human dpy-30 homolog (C. elegans) (DPY30), 20 µg |
CNY 2900.00 |
