CBR1 (NM_001757) Human Mass Spec Standard
CAT#: PH304950
CBR1 MS Standard C13 and N15-labeled recombinant protein (NP_001748)
View other "CBR1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CBR1 MS Standard C13 and N15-labeled recombinant protein (NP_001748) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204950 |
| Predicted MW | 30.4 kDa |
| Protein Sequence |
>RC204950 protein sequence
Red=Cloning site Green=Tags(s) MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001748 |
| RefSeq Size | 1321 |
| RefSeq ORF | 831 |
| Synonyms | CBR; hCBR1; PG-9-KR; SDR21C1 |
| Locus ID | 873 |
| Cytogenetics | 21q22.12 |
| Summary | The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400669 | CBR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400669 | Transient overexpression lysate of carbonyl reductase 1 (CBR1) |
CNY 3080.00 |
|
| TP304950 | Recombinant protein of human carbonyl reductase 1 (CBR1), 20 µg |
CNY 2900.00 |
