Torsin B (TOR1B) (NM_014506) Human Mass Spec Standard
CAT#: PH304937
TOR1B MS Standard C13 and N15-labeled recombinant protein (NP_055321)
View other "Torsin B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TOR1B MS Standard C13 and N15-labeled recombinant protein (NP_055321) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204937 |
| Predicted MW | 38 kDa |
| Protein Sequence |
>RC204937 protein sequence
Red=Cloning site Green=Tags(s) MLRAGWLRGAAALALLLAARVVAAFEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKL DLEEKLFGQHLATEVIFKALTGFRNNKNPKKPLTLSLHGWAGTGKNFVSQIVAENLHPKGLKSNFVHLFV STLHFPHEQKIKLYQDQLQKWIRGNVSACANSVFIFDEMDKLHPGIIDAIKPFLDYYEQVDGVSYRKAIF IFLSNAGGDLITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLE YRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055321 |
| RefSeq Size | 2774 |
| RefSeq ORF | 1008 |
| Synonyms | DQ1 |
| Locus ID | 27348 |
| Cytogenetics | 9q34.11 |
| Summary | The protein encoded by this gene is an ATPase found primarily in the endoplasmic reticulum and nuclear envelope. This gene has a highly-similar neighboring gene, TOR1A, that encodes a protein that is likely to interact in a complex with this protein. Finally, this protein may act as a chaperone and play a role in maintaining the integrity of the nuclear envelope and endoplasmic reticulum. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2015] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415210 | TOR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415210 | Transient overexpression lysate of torsin family 1, member B (torsin B) (TOR1B) |
CNY 3080.00 |
|
| TP304937 | Recombinant protein of human torsin family 1, member B (torsin B) (TOR1B), 20 µg |
CNY 2900.00 |
其它Torsin B产品
