hnRNP K (HNRNPK) (NM_031262) Human Mass Spec Standard
CAT#: PH304921
HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112552)
View other "hnRNP K" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112552) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204921 |
| Predicted MW | 51 kDa |
| Protein Sequence |
>RC204921 protein sequence
Red=Cloning site Green=Tags(s) METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112552 |
| RefSeq Size | 2935 |
| RefSeq ORF | 1389 |
| Synonyms | AUKS; CSBP; HNRPK; TUNP |
| Locus ID | 3190 |
| Cytogenetics | 9q21.32 |
| Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400779 | HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410602 | HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410603 | HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400779 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 1 |
CNY 3080.00 |
|
| LY410602 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 3 |
CNY 3080.00 |
|
| LY410603 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 2 |
CNY 3080.00 |
|
| PH301843 | HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_002131) |
CNY 19520.00 |
|
| PH319023 | HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112553) |
CNY 19520.00 |
|
| TP301843 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP304921 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP319023 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 2, 20 µg |
CNY 2900.00 |
其它hnRNP K产品


