FAM136A (NM_032822) Human Mass Spec Standard
CAT#: PH304914
FAM136A MS Standard C13 and N15-labeled recombinant protein (NP_116211)
View other "FAM136A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | FAM136A MS Standard C13 and N15-labeled recombinant protein (NP_116211) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204914 |
| Predicted MW | 15.6 kDa |
| Protein Sequence |
>RC204914 protein sequence
Red=Cloning site Green=Tags(s) MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTS ELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116211 |
| RefSeq Size | 1824 |
| RefSeq ORF | 414 |
| Locus ID | 84908 |
| Cytogenetics | 2p13.3 |
| Summary | This gene encodes a mitochondrially localized protein that is highly conserved across species. The gene is expressed in a variety of tissues including human lymphoblast cells and rat neurosensorial epithelium of the cristaampullaris. A mutation in this gene has been associated with familial Meniere's disease, a chronic disorder of the inner ear. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403203 | FAM136A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403203 | Transient overexpression lysate of family with sequence similarity 136, member A (FAM136A) |
CNY 3080.00 |
|
| TP304914 | Recombinant protein of human family with sequence similarity 136, member A (FAM136A), 20 µg |
CNY 2900.00 |
其它FAM136A产品
