p15 INK4b (CDKN2B) (NM_004936) Human Mass Spec Standard
CAT#: PH304895
CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_004927)
View other "p15 INK4b" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_004927) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204895 |
| Predicted MW | 14.5 kDa |
| Protein Sequence |
>RC204895 representing NM_004936
Red=Cloning site Green=Tags(s) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004927 |
| RefSeq Size | 3878 |
| RefSeq ORF | 414 |
| Synonyms | CDK4I; INK4B; MTS2; P15; p15INK4b; TP15 |
| Locus ID | 1030 |
| Cytogenetics | 9p21.3 |
| Summary | This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409193 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417638 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409193 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
CNY 3080.00 |
|
| LY417638 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1 |
CNY 3080.00 |
|
| PH317024 | CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_511042) |
CNY 19520.00 |
|
| TP304895 | Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317024 | Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, 20 µg |
CNY 2900.00 |
其它p15 INK4b产品
