LAGE3 (NM_006014) Human Mass Spec Standard
CAT#: PH304863
LAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_006005)
View other "LAGE3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | LAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_006005) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204863 |
Predicted MW | 14.8 kDa |
Protein Sequence |
>RC204863 protein sequence
Red=Cloning site Green=Tags(s) MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFP TPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPP VSR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006005 |
RefSeq Size | 964 |
RefSeq ORF | 429 |
Synonyms | CVG5; DXS9879E; DXS9951E; ESO3; GAMOS2; ITBA2; Pcc1 |
Locus ID | 8270 |
Cytogenetics | Xq28 |
Summary | This gene belongs to the ESO/LAGE gene family, members of which are clustered together on chromosome Xq28, and have similar exon-intron structures. Unlike the other family members which are normally expressed only in testis and activated in a wide range of human tumors, this gene is ubiquitously expressed in somatic tissues. The latter, combined with the finding that it is highly conserved in mouse and rat, suggests that the encoded protein is functionally important. An intronless pseudogene with high sequence similarity to this gene is located on chromosome 9. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401824 | LAGE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401824 | Transient overexpression lysate of L antigen family, member 3 (LAGE3) |
CNY 3080.00 |
|
TP304863 | Purified recombinant protein of Homo sapiens L antigen family, member 3 (LAGE3), 20 µg |
CNY 2900.00 |