Granzyme A (GZMA) (NM_006144) Human Mass Spec Standard
CAT#: PH304852
GZMA MS Standard C13 and N15-labeled recombinant protein (NP_006135)
View other "Granzyme A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GZMA MS Standard C13 and N15-labeled recombinant protein (NP_006135) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204852 |
| Predicted MW | 29 kDa |
| Protein Sequence |
>RC204852 protein sequence
Red=Cloning site Green=Tags(s) MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGD DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006135 |
| RefSeq Size | 913 |
| RefSeq ORF | 786 |
| Synonyms | CTLA3; HFSP |
| Locus ID | 3001 |
| Cytogenetics | 5q11.2 |
| Summary | Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
| Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416840 | GZMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416840 | Transient overexpression lysate of granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA) |
CNY 3080.00 |
|
| TP304852 | Recombinant protein of human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA), 20 µg |
CNY 2900.00 |
其它Granzyme A产品
