UBE2E2 (NM_152653) Human Mass Spec Standard
CAT#: PH304787
UBE2E2 MS Standard C13 and N15-labeled recombinant protein (NP_689866)
View other "UBE2E2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UBE2E2 MS Standard C13 and N15-labeled recombinant protein (NP_689866) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204787 |
| Predicted MW | 22.3 kDa |
| Protein Sequence |
>RC204787 protein sequence
Red=Cloning site Green=Tags(s) MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICL DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689866 |
| RefSeq Size | 1760 |
| RefSeq ORF | 603 |
| Synonyms | UBCH8 |
| Locus ID | 7325 |
| Cytogenetics | 3p24.3 |
| Summary | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407379 | UBE2E2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407379 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) (UBE2E2) |
CNY 3080.00 |
|
| TP304787 | Recombinant protein of human ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) (UBE2E2), 20 µg |
CNY 2900.00 |

