SERF2 (NM_001018108) Human Mass Spec Standard
CAT#: PH304784
SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118)
View other "SERF2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204784 |
Predicted MW | 6.9 kDa |
Protein Sequence |
>RC204784 protein sequence
Red=Cloning site Green=Tags(s) MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001018118 |
RefSeq Size | 3048 |
RefSeq ORF | 177 |
Synonyms | 4F5REL; FAM2C; H4F5REL; HsT17089 |
Locus ID | 10169 |
Cytogenetics | 15q15.3 |
Summary | Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates (PubMed:20723760).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422655 | SERF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422655 | Transient overexpression lysate of small EDRK-rich factor 2 (SERF2) |
CNY 3080.00 |
|
TP304784 | Recombinant protein of human small EDRK-rich factor 2 (SERF2), 20 µg |
CNY 2900.00 |