CLTRN (NM_020665) Human Mass Spec Standard
CAT#: PH304775
TMEM27 MS Standard C13 and N15-labeled recombinant protein (NP_065716)
View other "CLTRN" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMEM27 MS Standard C13 and N15-labeled recombinant protein (NP_065716) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204775 |
| Predicted MW | 25.2 kDa |
| Protein Sequence |
>RC204775 protein sequence
Red=Cloning site Green=Tags(s) MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEIS HVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSV PIWIIIFGVIFCIIIVAIALLILSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDPLDMKGGHIND AFMTEDERLTPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065716 |
| RefSeq Size | 1580 |
| RefSeq ORF | 666 |
| Synonyms | NX-17; NX17; TMEM27 |
| Locus ID | 57393 |
| Cytogenetics | Xp22.2 |
| Summary | This gene encodes a type 1 transmembrane protein that is important for trafficking amino acid transporters to the apical brush border of proximal tubules. The encoded protein binds to amino acid transporters and regulates their expression on the plasma membrane. It also plays a role in controlling insulin exocytosis by regulating formation of the SNARE (soluble N-ethylmaleimide-sensitive-factor attachment protein receptor) complex in pancreatic beta cells. The extracellular domain of the encoded protein may be cleaved and shed from the plasma membrane specifically in pancreatic beta cells. [provided by RefSeq, Jun 2013] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412403 | TMEM27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412403 | Transient overexpression lysate of transmembrane protein 27 (TMEM27) |
CNY 3080.00 |
|
| TP304775 | Recombinant protein of human transmembrane protein 27 (TMEM27), 20 µg |
CNY 2900.00 |
