CLIC2 (NM_001289) Human Mass Spec Standard
CAT#: PH304727
CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280)
View other "CLIC2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204727 |
Predicted MW | 28.4 kDa |
Protein Sequence |
>RC204727 protein sequence
Red=Cloning site Green=Tags(s) MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001280 |
RefSeq Size | 2694 |
RefSeq ORF | 741 |
Synonyms | CLCNL2; CLIC2b; MRXS32; XAP121 |
Locus ID | 1193 |
Cytogenetics | Xq28 |
Summary | This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420025 | CLIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420025 | Transient overexpression lysate of chloride intracellular channel 2 (CLIC2) |
CNY 3080.00 |
|
TP304727 | Recombinant protein of human chloride intracellular channel 2 (CLIC2), 20 µg |
CNY 2900.00 |
|
TP720238 | Recombinant protein of human chloride intracellular channel 2 (CLIC2) |
CNY 1800.00 |