LOX 1 (OLR1) (NM_002543) Human Mass Spec Standard
CAT#: PH304704
OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534)
View other "LOX 1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204704 |
Predicted MW | 31 kDa |
Protein Sequence |
>RC204704 protein sequence
Red=Cloning site Green=Tags(s) MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002534 |
RefSeq Size | 2533 |
RefSeq ORF | 819 |
Synonyms | CLEC8A; LOX1; LOXIN; SCARE1; SLOX1 |
Locus ID | 4973 |
Cytogenetics | 12p13.2 |
Summary | This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400904 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432642 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400904 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1) |
CNY 3,080.00 |
|
LY432642 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2 |
CNY 3,080.00 |
|
TP304704 | Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), 20 µg |
CNY 2,900.00 |
|
TP720433 | Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2. |
CNY 3,140.00 |