beta Sarcoglycan (SGCB) (NM_000232) Human Mass Spec Standard
CAT#: PH304699
SGCB MS Standard C13 and N15-labeled recombinant protein (NP_000223)
View other "beta Sarcoglycan" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SGCB MS Standard C13 and N15-labeled recombinant protein (NP_000223) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204699 |
| Predicted MW | 34.8 kDa |
| Protein Sequence |
>RC204699 protein sequence
Red=Cloning site Green=Tags(s) MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITS NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000223 |
| RefSeq Size | 4295 |
| RefSeq ORF | 954 |
| Synonyms | A3b; LGMD2E; LGMDR4; SGC |
| Locus ID | 6443 |
| Cytogenetics | 4q12 |
| Summary | This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy.[provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400093 | SGCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400093 | Transient overexpression lysate of sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB) |
CNY 3080.00 |
|
| TP304699 | Recombinant protein of human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), 20 µg |
CNY 2900.00 |
其它beta Sarcoglycan产品
