DARC (ACKR1) (NM_002036) Human Mass Spec Standard
CAT#: PH304680
DARC MS Standard C13 and N15-labeled recombinant protein (NP_002027)
View other "DARC" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DARC MS Standard C13 and N15-labeled recombinant protein (NP_002027) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204680 |
Predicted MW | 35.6 kDa |
Protein Sequence |
>RC204680 protein sequence
Red=Cloning site Green=Tags(s) MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002027 |
RefSeq Size | 2024 |
RefSeq ORF | 1008 |
Synonyms | CCBP1; CD234; DARC; DARC/ACKR1; Dfy; FY; GPD; GpFy; WBCQ1 |
Locus ID | 2532 |
Cytogenetics | 1q23.2 |
Summary | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400744 | ACKR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426584 | ACKR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400744 | Transient overexpression lysate of Duffy blood group, chemokine receptor (DARC), transcript variant 2 |
CNY 3080.00 |
|
LY426584 | Transient overexpression lysate of Duffy blood group, chemokine receptor (DARC), transcript variant 1 |
CNY 3080.00 |
|
TP304680 | Recombinant protein of human Duffy blood group, chemokine receptor (DARC), transcript variant 2, 20 µg |
CNY 2900.00 |