Langerin (CD207) (NM_015717) Human Mass Spec Standard
CAT#: PH304669
CD207 MS Standard C13 and N15-labeled recombinant protein (NP_056532)
View other "Langerin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CD207 MS Standard C13 and N15-labeled recombinant protein (NP_056532) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204669 |
| Predicted MW | 36.7 kDa |
| Protein Sequence |
>RC204669 protein sequence
Red=Cloning site Green=Tags(s) MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGT ISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQIL TRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFS LIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARF WIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056532 |
| RefSeq Size | 1886 |
| RefSeq ORF | 984 |
| Synonyms | CLEC4K |
| Locus ID | 50489 |
| Cytogenetics | 2p13.3 |
| Summary | The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity. [provided by RefSeq, Aug 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402461 | CD207 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402461 | Transient overexpression lysate of CD207 molecule, langerin (CD207) |
CNY 3080.00 |
|
| TP304669 | Recombinant protein of human CD207 molecule, langerin (CD207), 20 µg |
CNY 2900.00 |
其它Langerin产品


