Arginase 1 (ARG1) (NM_000045) Human Mass Spec Standard
CAT#: PH304649
ARG1 MS Standard C13 and N15-labeled recombinant protein (NP_000036)
View other "Arginase 1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ARG1 MS Standard C13 and N15-labeled recombinant protein (NP_000036) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204649 |
| Predicted MW | 34.7 kDa |
| Protein Sequence |
>RC204649 protein sequence
Red=Cloning site Green=Tags(s) MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNP RSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNL HGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK VMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000036 |
| RefSeq Size | 1475 |
| RefSeq ORF | 966 |
| Locus ID | 383 |
| Cytogenetics | 6q23.2 |
| Summary | Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The Role of Arginine Metabolism in Oral Tongue Squamous Cell Carcinoma
,null,
Cancers
,PubMed ID 34885177
[ARG1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424951 | ARG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424951 | Transient overexpression lysate of arginase, liver (ARG1) |
CNY 3080.00 |
|
| TP304649 | Recombinant protein of human arginase, liver (ARG1), 20 µg |
CNY 2900.00 |
|
| TP721013 | Purified recombinant protein of Human arginase, liver (ARG1) |
CNY 1800.00 |
其它Arginase 1产品

