CCN5 (NM_003881) Human Mass Spec Standard
CAT#: PH304636
WISP2 MS Standard C13 and N15-labeled recombinant protein (NP_003872)
View other "CCN5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | WISP2 MS Standard C13 and N15-labeled recombinant protein (NP_003872) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204636 |
Predicted MW | 26.8 kDa |
Protein Sequence |
>RC204636 protein sequence
Red=Cloning site Green=Tags(s) MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVC DASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRL PSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGL GMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003872 |
RefSeq Size | 1433 |
RefSeq ORF | 750 |
Synonyms | CT58; CTGF-L; WISP2 |
Locus ID | 8839 |
Cytogenetics | 20q13.12 |
Summary | This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401279 | WISP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401279 | Transient overexpression lysate of WNT1 inducible signaling pathway protein 2 (WISP2) |
CNY 3080.00 |
|
TP304636 | Recombinant protein of human WNT1 inducible signaling pathway protein 2 (WISP2), 20 µg |
CNY 2900.00 |