IMPACT (NM_018439) Human Mass Spec Standard
CAT#: PH304631
IMPACT MS Standard C13 and N15-labeled recombinant protein (NP_060909)
View other "IMPACT" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IMPACT MS Standard C13 and N15-labeled recombinant protein (NP_060909) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204631 |
Predicted MW | 36.5 kDa |
Protein Sequence |
>RC204631 protein sequence
Red=Cloning site Green=Tags(s) MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIY QLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDD LILACQPESSVKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENK KIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKH INNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRNEH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060909 |
RefSeq Size | 3764 |
RefSeq ORF | 960 |
Synonyms | RWDD5 |
Locus ID | 55364 |
Cytogenetics | 18q11.2 |
Summary | Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412993 | IMPACT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412993 | Transient overexpression lysate of Impact homolog (mouse) (IMPACT) |
CNY 3080.00 |
|
TP304631 | Recombinant protein of human Impact homolog (mouse) (IMPACT), 20 µg |
CNY 2900.00 |