HEPC (HAMP) (NM_021175) Human Mass Spec Standard
CAT#: PH304620
HAMP MS Standard C13 and N15-labeled recombinant protein (NP_066998)
View other "HEPC" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | HAMP MS Standard C13 and N15-labeled recombinant protein (NP_066998) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204620 |
| Predicted MW | 9.4 kDa |
| Protein Sequence |
>RC204620 protein sequence
Red=Cloning site Green=Tags(s) MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC GCCHRSKCGMCCKT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066998 |
| RefSeq Size | 430 |
| RefSeq ORF | 252 |
| Synonyms | HEPC; HFE2B; LEAP1; PLTR |
| Locus ID | 57817 |
| Cytogenetics | 19q13.12 |
| Summary | The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402850 | HAMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402850 | Transient overexpression lysate of hepcidin antimicrobial peptide (HAMP) |
CNY 3080.00 |
|
| TP304620 | Recombinant protein of human hepcidin antimicrobial peptide (HAMP), 20 µg |
CNY 2900.00 |
|
| TP721154 | Purified recombinant protein of Human hepcidin antimicrobial peptide (HAMP) |
CNY 1800.00 |
