Cytochrome P450 2C8 (CYP2C8) (NM_000770) Human Mass Spec Standard
CAT#: PH304605
CYP2C8 MS Standard C13 and N15-labeled recombinant protein (NP_000761)
View other "Cytochrome P450 2C8" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CYP2C8 MS Standard C13 and N15-labeled recombinant protein (NP_000761) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204605 |
| Predicted MW | 55.8 kDa |
| Protein Sequence |
>RC204605 protein sequence
Red=Cloning site Green=Tags(s) MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFG MNPIVVFHGYESVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRS IEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNS PWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKS EFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000761 |
| RefSeq Size | 1924 |
| RefSeq ORF | 1470 |
| Synonyms | CPC8; CYP2C8DM; CYPIIC8; MP-12/MP-20 |
| Locus ID | 1558 |
| Cytogenetics | 10q23.33 |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, benzo(a)pyrene, 7-ethyoxycoumarin, and the anti-cancer drug taxol. This gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome, P450, Transmembrane |
| Protein Pathways | Arachidonic acid metabolism, Drug metabolism - cytochrome P450, Linoleic acid metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400261 | CYP2C8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400261 | Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 8 (CYP2C8) |
CNY 3080.00 |
|
| TP304605 | Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 8 (CYP2C8), 20 µg |
CNY 2900.00 |
其它Cytochrome P450 2C8产品
