AP2 alpha (TFAP2A) (NM_001032280) Human Mass Spec Standard
CAT#: PH304603
TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451)
View other "AP2 alpha" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204603 |
| Predicted MW | 47.2 kDa |
| Protein Sequence |
>RC204603 protein sequence
Red=Cloning site Green=Tags(s) MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHV NDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGD LSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPG RLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANV TLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDR SPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNA KSSDKEEKHRK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001027451 |
| RefSeq Size | 3808 |
| RefSeq ORF | 1293 |
| Synonyms | AP-2; AP-2alpha; AP2TF; BOFS; TFAP2 |
| Locus ID | 7020 |
| Cytogenetics | 6p24.3 |
| Summary | The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420895 | TFAP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422292 | TFAP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420895 | Transient overexpression lysate of transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 3 |
CNY 4840.00 |
|
| LY422292 | Transient overexpression lysate of transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 2 |
CNY 3080.00 |
|
| TP304603 | Recombinant protein of human transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 2, 20 µg |
CNY 2900.00 |
其它AP2 alpha产品
