ARL8A (NM_138795) Human Mass Spec Standard
CAT#: PH304596
ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150)
View other "ARL8A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204596 |
| Predicted MW | 21.4 kDa |
| Protein Sequence |
>RC204596 protein sequence
Red=Cloning site Green=Tags(s) MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDE KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620150 |
| RefSeq Size | 1815 |
| RefSeq ORF | 558 |
| Synonyms | ARL10B; GIE2 |
| Locus ID | 127829 |
| Cytogenetics | 1q32.1 |
| Summary | Plays a role in lysosome motility (By similarity). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403368 | ARL8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403368 | Transient overexpression lysate of ADP-ribosylation factor-like 8A (ARL8A) |
CNY 3080.00 |
|
| TP304596 | Recombinant protein of human ADP-ribosylation factor-like 8A (ARL8A), 20 µg |
CNY 2900.00 |
