MRGPRF (NM_145015) Human Mass Spec Standard
CAT#: PH304556
MRGPRF MS Standard C13 and N15-labeled recombinant protein (NP_659452)
View other "MRGPRF" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MRGPRF MS Standard C13 and N15-labeled recombinant protein (NP_659452) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204556 |
| Predicted MW | 38.2 kDa |
| Protein Sequence |
>RC204556 protein sequence
Red=Cloning site Green=Tags(s) MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659452 |
| RefSeq Size | 2308 |
| RefSeq ORF | 1029 |
| Synonyms | GPR140; GPR168; MRGF; RTA |
| Locus ID | 116535 |
| Cytogenetics | 11q13.3 |
| Summary | Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403413 | MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420613 | MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426018 | MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403413 | Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 2 |
CNY 3080.00 |
|
| LY420613 | Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 1 |
CNY 3080.00 |
|
| TP304556 | Recombinant protein of human MAS-related GPR, member F (MRGPRF), transcript variant 2, 20 µg |
CNY 2900.00 |
