CD84 (NM_003874) Human Mass Spec Standard
CAT＃: PH304477
CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865)
View other "CD84" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204477 |
| Predicted MW | 36.9 kDa |
| Protein Sequence |
>RC204477 protein sequence
Red=Cloning site Green=Tags(s) MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYD EILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003865 |
| RefSeq Size | 8245 |
| RefSeq ORF | 984 |
| Synonyms | hCD84; LY9B; mCD84; SLAMF5 |
| Locus ID | 8832 |
| Cytogenetics | 1q23.3 |
| Summary | This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401277 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432804 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432917 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401277 | Transient overexpression lysate of CD84 molecule (CD84) |
CNY 3080.00 |
|
| LY432804 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 3 |
CNY 3080.00 |
|
| LY432917 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 1 |
CNY 3080.00 |
|
| TP304477 | Recombinant protein of human CD84 molecule (CD84), 20 µg |
CNY 2900.00 |
|
| TP329804 | Purified recombinant protein of Homo sapiens CD84 molecule (CD84), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP723970 | Human SLAMF5 Protein, mFc-His Tag |
CNY 4925.00 |
