BMAL1 (ARNTL) (NM_001030273) Human Mass Spec Standard
CAT#: PH304464
ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444)
View other "BMAL1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204464 |
| Predicted MW | 64.2 kDa |
| Protein Sequence |
>RC204464 protein sequence
Red=Cloning site Green=Tags(s) MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT VLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYS QNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKC NRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSH VVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVL QTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSM DSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDAS SPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVI MSLLEADAGLGGPVDFSDLPWPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001025444 |
| RefSeq Size | 2879 |
| RefSeq ORF | 1749 |
| Synonyms | bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC |
| Locus ID | 406 |
| Cytogenetics | 11p15.3 |
| Summary | The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Circadian rhythm - mammal |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400474 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422246 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422247 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400474 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1 |
CNY 3080.00 |
|
| LY422246 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2 |
CNY 4840.00 |
|
| LY422247 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3 |
CNY 3080.00 |
|
| PH307870 | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001169) |
CNY 19520.00 |
|
| PH317474 | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443) |
CNY 19520.00 |
|
| TP304464 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP307870 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317474 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, 20 µg |
CNY 2900.00 |
