HNF1 beta (HNF1B) (NM_000458) Human Mass Spec Standard
CAT#: PH304453
HNF1B MS Standard C13 and N15-labeled recombinant protein (NP_000449)
View other "HNF1 beta" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HNF1B MS Standard C13 and N15-labeled recombinant protein (NP_000449) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204453 |
Predicted MW | 61.3 kDa |
Protein Sequence |
>RC204453 protein sequence
Red=Cloning site Green=Tags(s) MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHA KGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVV DVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFS QQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSP SKAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGV RYSQQGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHSPHQQPLMQQS PGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSISTLTNMSSSKQCPLQAW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000449 |
RefSeq Size | 2842 |
RefSeq ORF | 1671 |
Synonyms | ADTKD3; FJHN; HNF-1-beta; HNF-1B; HNF1beta; HNF2; HPC11; LF-B3; LFB3; MODY5; RCAD; T2D; TCF-2; TCF2; VHNF1 |
Locus ID | 6928 |
Cytogenetics | 17q12 |
Summary | This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400162 | HNF1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431461 | HNF1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400162 | Transient overexpression lysate of HNF1 homeobox B (HNF1B), transcript variant 1 |
CNY 3080.00 |
|
LY431461 | Transient overexpression lysate of HNF1 homeobox B (HNF1B), transcript variant 2 |
CNY 3080.00 |
|
TP304453 | Recombinant protein of human HNF1 homeobox B (HNF1B), 20 µg |
CNY 2900.00 |
其它HNF1 beta产品