BLBP (FABP7) (NM_001446) Human Mass Spec Standard
CAT#: PH304449
FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437)
View other "BLBP" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204449 |
| Predicted MW | 14.9 kDa |
| Protein Sequence |
>RC204449 protein sequence
Red=Cloning site Green=Tags(s) MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001437 |
| RefSeq Size | 1005 |
| RefSeq ORF | 396 |
| Synonyms | B-FABP; BLBP; FABPB; MRG |
| Locus ID | 2173 |
| Cytogenetics | 6q22.31 |
| Summary | The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016] |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419933 | FABP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419933 | Transient overexpression lysate of fatty acid binding protein 7, brain (FABP7) |
CNY 3080.00 |
|
| TP304449 | Recombinant protein of human fatty acid binding protein 7, brain (FABP7), 20 µg |
CNY 2900.00 |
|
| TP720119 | Recombinant protein of human fatty acid binding protein 7, brain (FABP7) |
CNY 1800.00 |

