ICT1 (MRPL58) (NM_001545) Human Mass Spec Standard
CAT#: PH304448
ICT1 MS Standard C13 and N15-labeled recombinant protein (NP_001536)
View other "ICT1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | ICT1 MS Standard C13 and N15-labeled recombinant protein (NP_001536) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204448 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC204448 protein sequence
Red=Cloning site Green=Tags(s) MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADS DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESS RYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001536 |
RefSeq Size | 888 |
RefSeq ORF | 618 |
Synonyms | DS-1; DS1; ICT1; MRP-L58 |
Locus ID | 3396 |
Cytogenetics | 17q25.1 |
Summary | The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419875 | ICT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419875 | Transient overexpression lysate of immature colon carcinoma transcript 1 (ICT1) |
CNY 3080.00 |
|
TP304448 | Recombinant protein of human immature colon carcinoma transcript 1 (ICT1), 20 µg |
CNY 2900.00 |