CDK2AP1 (NM_004642) Human Mass Spec Standard
CAT#: PH304442
CDK2AP1 MS Standard C13 and N15-labeled recombinant protein (NP_004633)
View other "CDK2AP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CDK2AP1 MS Standard C13 and N15-labeled recombinant protein (NP_004633) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204442 |
| Predicted MW | 12.4 kDa |
| Protein Sequence |
>RC204442 protein sequence
Red=Cloning site Green=Tags(s) MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004633 |
| RefSeq Size | 1655 |
| RefSeq ORF | 345 |
| Synonyms | doc-1; DOC1; DORC1; p12DOC-1; ST19 |
| Locus ID | 8099 |
| Cytogenetics | 12q24.31 |
| Summary | The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401472 | CDK2AP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401472 | Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) |
CNY 3080.00 |
|
| TP304442 | Recombinant protein of human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), 20 µg |
CNY 2900.00 |
其它CDK2AP1产品
