SGK3 (NM_013257) Human Mass Spec Standard
CAT＃: PH304416
SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389)
View other "SGK3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204416 |
| Predicted MW | 57.1 kDa |
| Protein Sequence |
>RC204416 protein sequence
Red=Cloning site Green=Tags(s) MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP SEDLFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037389 |
| RefSeq Size | 4206 |
| RefSeq ORF | 1488 |
| Synonyms | CISK; SGK2; SGKL |
| Locus ID | 23678 |
| Cytogenetics | 8q13.1 |
| Summary | This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406888 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415716 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422403 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY406888 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2 |
CNY 4840.00 |
|
| LY415716 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1 |
CNY 3080.00 |
|
| LY422403 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3 |
CNY 4840.00 |
|
| TP304416 | Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760266 | Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
