AK3 (NM_016282) Human Mass Spec Standard
CAT#: PH304408
AK3 MS Standard C13 and N15-labeled recombinant protein (NP_057366)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AK3 MS Standard C13 and N15-labeled recombinant protein (NP_057366) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204408 |
| Predicted MW | 25.6 kDa |
| Protein Sequence |
>RC204408 protein sequence
Red=Cloning site Green=Tags(s) MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA FLQTKVPQRSQKASVTP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057366 |
| RefSeq Size | 4333 |
| RefSeq ORF | 681 |
| Synonyms | AK3L1; AK6; AKL3L; AKL3L1; FIX |
| Locus ID | 50808 |
| Cytogenetics | 9p24.1 |
| Summary | The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414079 | AK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414079 | Transient overexpression lysate of adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP304408 | Recombinant protein of human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
