SLP76 (LCP2) (NM_005565) Human Mass Spec Standard
CAT#: PH304404
LCP2 MS Standard C13 and N15-labeled recombinant protein (NP_005556)
View other "SLP76" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 3600.00
Specifications
| Product Data | |
| Description | LCP2 MS Standard C13 and N15-labeled recombinant protein (NP_005556) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204404 |
| Predicted MW | 60.2 kDa |
| Protein Sequence |
>RC204404 protein sequence
Red=Cloning site Green=Tags(s) MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005556 |
| RefSeq Size | 2472 |
| RefSeq ORF | 1599 |
| Synonyms | IMD81; SLP-76; SLP76 |
| Locus ID | 3937 |
| Cytogenetics | 5q35.1 |
| Summary | This gene encodes an adapter protein that acts as a substrate of the T cell antigen receptor (TCR)-activated protein tyrosine kinase pathway. The encoded protein associates with growth factor receptor bound protein 2, and is thought to play a role TCR-mediated intracellular signal transduction. A similar protein in mouse plays a role in normal T-cell development and activation. Mice lacking this gene show subcutaneous and intraperitoneal fetal hemorrhaging, dysfunctional platelets and impaired viability. [provided by RefSeq, Nov 2016] |
| Protein Pathways | Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417227 | LCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417227 | Transient overexpression lysate of lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) (LCP2) |
CNY 3080.00 |
|
| TP304404 | Recombinant protein of human lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) (LCP2), 20 µg |
CNY 2900.00 |
|
| TP721201 | Purified recombinant protein of Human lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) (LCP2) |
CNY 1800.00 |
