POP5 (NM_015918) Human Mass Spec Standard
CAT#: PH304400
POP5 MS Standard C13 and N15-labeled recombinant protein (NP_057002)
View other "POP5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POP5 MS Standard C13 and N15-labeled recombinant protein (NP_057002) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204400 |
| Predicted MW | 18.8 kDa |
| Protein Sequence |
>RC204400 protein sequence
Red=Cloning site Green=Tags(s) MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK SVTRSCLLEEEEESGEEAAEAME myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057002 |
| RefSeq Size | 801 |
| RefSeq ORF | 489 |
| Synonyms | hPop5; HSPC004; RPP2; RPP20 |
| Locus ID | 51367 |
| Cytogenetics | 12q24.31 |
| Summary | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:11413139, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414321 | POP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414321 | Transient overexpression lysate of processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) (POP5), transcript variant 1 |
CNY 3080.00 |
|
| TP304400 | Recombinant protein of human processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) (POP5), transcript variant 1, 20 µg |
CNY 2900.00 |
