POP5 (NM_015918) Human Mass Spec Standard
CAT#: PH304400
POP5 MS Standard C13 and N15-labeled recombinant protein (NP_057002)
View other "POP5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | POP5 MS Standard C13 and N15-labeled recombinant protein (NP_057002) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204400 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC204400 protein sequence
Red=Cloning site Green=Tags(s) MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK SVTRSCLLEEEEESGEEAAEAME myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057002 |
RefSeq Size | 801 |
RefSeq ORF | 489 |
Synonyms | hPop5; HSPC004; RPP2; RPP20 |
Locus ID | 51367 |
Cytogenetics | 12q24.31 |
Summary | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:11413139, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414321 | POP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414321 | Transient overexpression lysate of processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) (POP5), transcript variant 1 |
CNY 3080.00 |
|
TP304400 | Recombinant protein of human processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) (POP5), transcript variant 1, 20 µg |
CNY 2900.00 |