ZNF580 (NM_207115) Human Mass Spec Standard
CAT#: PH304398
ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_996998)
View other "ZNF580" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_996998) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204398 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC204398 protein sequence
Red=Cloning site Green=Tags(s) MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA THRARAGPPHTCPLCPRRFQDAAELAQHVRLH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_996998 |
RefSeq Size | 1152 |
RefSeq ORF | 516 |
Locus ID | 51157 |
Cytogenetics | 19q13.42 |
Summary | Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404118 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414134 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431774 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404118 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 2 |
CNY 3080.00 |
|
LY414134 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 1 |
CNY 3080.00 |
|
LY431774 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 3 |
CNY 3080.00 |
|
PH314316 | ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_057286) |
CNY 19520.00 |
|
TP304398 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP314316 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP328746 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 3, 20 µg |
CNY 2900.00 |