PTP alpha (PTPRA) (NM_080841) Human Mass Spec Standard
CAT#: PH304392
PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_543031)
View other "PTP alpha" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_543031) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204392 |
| Predicted MW | 89.7 kDa |
| Protein Sequence |
>RC204392 protein sequence
Red=Cloning site Green=Tags(s) MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNIT LGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDE TPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYP PLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEG VPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGC WTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKA CNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALL EHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIP YEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG QEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGM ISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLE QYEFCYKVVQEYIDAFSDYANFK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_543031 |
| RefSeq Size | 3153 |
| RefSeq ORF | 2379 |
| Synonyms | HEPTP; HLPR; HPTPA; HPTPalpha; LRP; PTPA; PTPRL2; R-PTP-alpha; RPTPA |
| Locus ID | 5786 |
| Cytogenetics | 20p13 |
| Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401026 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409009 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409010 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401026 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 1 |
CNY 3080.00 |
|
| LY409009 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 2 |
CNY 3080.00 |
|
| LY409010 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 3 |
CNY 3080.00 |
|
| PH322592 | PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_002827) |
CNY 19520.00 |
|
| TP304392 | Recombinant protein of human protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP322592 | Recombinant protein of human protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 1, 20 µg |
CNY 2900.00 |
其它PTP alpha产品
