HNRPAB (HNRNPAB) (NM_031266) Human Mass Spec Standard
CAT#: PH304360
HNRNPAB MS Standard C13 and N15-labeled recombinant protein (NP_112556)
View other "HNRPAB" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HNRNPAB MS Standard C13 and N15-labeled recombinant protein (NP_112556) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204360 |
| Predicted MW | 35.8 kDa |
| Protein Sequence |
>RC204360 representing NM_031266
Red=Cloning site Green=Tags(s) MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVI DPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKK VLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGY GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112556 |
| RefSeq Size | 1837 |
| RefSeq ORF | 996 |
| Synonyms | ABBP1; HNRPAB |
| Locus ID | 3182 |
| Cytogenetics | 5q35.3 |
| Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410605 | HNRNPAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417947 | HNRNPAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410605 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1 |
CNY 3080.00 |
|
| LY417947 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 2 |
CNY 3080.00 |
|
| TP304360 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1, 20 µg |
CNY 2900.00 |
