CTHRC1 (NM_138455) Human Mass Spec Standard
CAT#: PH304348
CTHRC1 MS Standard C13 and N15-labeled recombinant protein (NP_612464)
View other "CTHRC1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CTHRC1 MS Standard C13 and N15-labeled recombinant protein (NP_612464) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204348 |
| Predicted MW | 26.2 kDa |
| Protein Sequence |
>RC204348 protein sequence
Red=Cloning site Green=Tags(s) MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPG ANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVL FSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVD VAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_612464 |
| RefSeq Size | 1279 |
| RefSeq ORF | 729 |
| Locus ID | 115908 |
| Cytogenetics | 8q22.3 |
| Summary | This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408605 | CTHRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408605 | Transient overexpression lysate of collagen triple helix repeat containing 1 (CTHRC1) |
CNY 3080.00 |
|
| TP304348 | Recombinant protein of human collagen triple helix repeat containing 1 (CTHRC1), 20 µg |
CNY 2900.00 |
