Syntaxin 16 (STX16) (NM_003763) Human Mass Spec Standard
CAT#: PH304347
STX16 MS Standard C13 and N15-labeled recombinant protein (NP_003754)
View other "Syntaxin 16" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | STX16 MS Standard C13 and N15-labeled recombinant protein (NP_003754) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204347 |
Predicted MW | 34.8 kDa |
Protein Sequence |
>RC204347 protein sequence
Red=Cloning site Green=Tags(s) MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGR IKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNV VASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTL MVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRK MLVILILFVIIIVLIVVLVGVKSR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003754 |
RefSeq Size | 4915 |
RefSeq ORF | 912 |
Synonyms | SYN16 |
Locus ID | 8675 |
Cytogenetics | 20q13.32 |
Summary | This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418449 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424352 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425029 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427489 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418449 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 2 |
CNY 3080.00 |
|
LY424352 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 1 |
CNY 3080.00 |
|
LY425029 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 1 |
CNY 3080.00 |
|
LY427489 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 4 |
CNY 3080.00 |
|
TP304347 | Recombinant protein of human syntaxin 16 (STX16), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Syntaxin 16产品