TXNL6 (NXNL1) (NM_138454) Human Mass Spec Standard
CAT#: PH304346
NXNL1 MS Standard C13 and N15-labeled recombinant protein (NP_612463)
View other "TXNL6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NXNL1 MS Standard C13 and N15-labeled recombinant protein (NP_612463) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204346 |
| Predicted MW | 23.9 kDa |
| Protein Sequence |
>RC204346 protein sequence
Red=Cloning site Green=Tags(s) MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG LF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_612463 |
| RefSeq Size | 948 |
| RefSeq ORF | 636 |
| Synonyms | RDCVF; TXNL6 |
| Locus ID | 115861 |
| Cytogenetics | 19p13.11 |
| Summary | Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408604 | NXNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408604 | Transient overexpression lysate of nucleoredoxin-like 1 (NXNL1) |
CNY 3080.00 |
|
| TP304346 | Recombinant protein of human nucleoredoxin-like 1 (NXNL1), 20 µg |
CNY 2900.00 |
