TID1 (DNAJA3) (NM_005147) Human Mass Spec Standard
CAT#: PH304240
DNAJA3 MS Standard C13 and N15-labeled recombinant protein (NP_005138)
View other "TID1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | DNAJA3 MS Standard C13 and N15-labeled recombinant protein (NP_005138) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204240 |
| Predicted MW | 52.5 kDa |
| Protein Sequence |
>RC204240 protein sequence
Red=Cloning site Green=Tags(s) MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT GTKHYPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005138 |
| RefSeq Size | 2780 |
| RefSeq ORF | 1440 |
| Synonyms | HCA57; hTID-1; TID1 |
| Locus ID | 9093 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes a member of the DNAJ/Hsp40 protein family. DNAJ/Hsp40 proteins stimulate the ATPase activity of Hsp70 chaperones and play critical roles in protein folding, degradation, and multimeric complex assembly. The encoded protein is localized to mitochondria and mediates several cellular processes including proliferation, survival and apoptotic signal transduction. The encoded protein also plays a critical role in tumor suppression through interactions with oncogenic proteins including ErbB2 and the p53 tumor suppressor protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417489 | DNAJA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427556 | DNAJA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417489 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 1 |
CNY 3080.00 |
|
| LY427556 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 2 |
CNY 3080.00 |
|
| TP304240 | Purified recombinant protein of Homo sapiens DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 1, 20 µg |
CNY 2900.00 |
