BTN2A2 (NM_006995) Human Mass Spec Standard
CAT＃: PH304232
BTN2A2 MS Standard C13 and N15-labeled recombinant protein (NP_008926)
View other "BTN2A2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | BTN2A2 MS Standard C13 and N15-labeled recombinant protein (NP_008926) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204232 |
| Predicted MW | 59.1 kDa |
| Protein Sequence |
>RC204232 protein sequence
Red=Cloning site Green=Tags(s) MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRW FRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEA ILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTA VIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMA VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVR RGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL EMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDD SPIFICPALTGASGVMVPEEGLKLHRVGTHQSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008926 |
| RefSeq Size | 3602 |
| RefSeq ORF | 1569 |
| Synonyms | BT2.2; BTF2; BTN2.2 |
| Locus ID | 10385 |
| Cytogenetics | 6p22.2 |
| Summary | Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405693 | BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416278 | BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434155 | BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405693 | Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 2 |
CNY 3080.00 |
|
| LY416278 | Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 1 |
CNY 3080.00 |
|
| LY434155 | Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 5 |
CNY 3080.00 |
|
| TP304232 | Purified recombinant protein of Homo sapiens butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 1, 20 µg |
CNY 2900.00 |
