SIL1 (NM_001037633) Human Mass Spec Standard
CAT#: PH304204
SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032722)
View other "SIL1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032722) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204204 |
| Predicted MW | 52.1 kDa |
| Protein Sequence |
>RC204204 protein sequence
Red=Cloning site Green=Tags(s) MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVF HPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLDINTNTYTSQDLKSALAKFKE GAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIETDMQIMVRLINKFNSSSSSLEEKIAALFDLE YYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATE QPLTAKKKVLFALCSLLRHFPYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEA ELTQEMSPEKLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001032722 |
| RefSeq Size | 1996 |
| RefSeq ORF | 1383 |
| Synonyms | BAP; MSS; ULG5 |
| Locus ID | 64374 |
| Cytogenetics | 5q31.2 |
| Summary | This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Protease, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402924 | SIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421971 | SIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402924 | Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2 |
CNY 3080.00 |
|
| LY421971 | Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1 |
CNY 3080.00 |
|
| PH311850 | SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_071909) |
CNY 19520.00 |
|
| TP304204 | Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP311850 | Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, 20 µg |
CNY 2900.00 |
