ERK1 (MAPK3) (NM_002746) Human Mass Spec Standard
CAT#: PH304196
MAPK3 MS Standard C13 and N15-labeled recombinant protein (NP_002737)
View other "ERK1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MAPK3 MS Standard C13 and N15-labeled recombinant protein (NP_002737) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204196 |
| Predicted MW | 43.1 kDa |
| Protein Sequence |
>RC204196 protein sequence
Red=Cloning site Green=Tags(s) MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSN DHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWY RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNY LQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAM ELDDLPKERLKELIFQETARFQPGVLEAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002737 |
| RefSeq Size | 1902 |
| RefSeq ORF | 1137 |
| Synonyms | ERK-1; ERK1; ERT2; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK; P44ERK1; P44MAPK; PRKM3 |
| Locus ID | 5595 |
| Cytogenetics | 16p11.2 |
| Summary | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
| Protein Pathways | Acute myeloid leukemia, Adherens junction, Alzheimer's disease, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Dorso-ventral axis formation, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, mTOR signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Non-small cell lung cancer, Oocyte meiosis, Pancreatic cancer, Pathways in cancer, Prion diseases, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, TGF-beta signaling pathway, Thyroid cancer, Toll-like receptor signaling pathway, Type II diabetes mellitus, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400968 | MAPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421885 | MAPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425672 | MAPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426307 | MAPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400968 | Transient overexpression lysate of mitogen-activated protein kinase 3 (MAPK3), transcript variant 1 |
CNY 3080.00 |
|
| LY421885 | Transient overexpression lysate of mitogen-activated protein kinase 3 (MAPK3), transcript variant 2 |
CNY 3080.00 |
|
| LY426307 | Transient overexpression lysate of mitogen-activated protein kinase 3 (MAPK3), transcript variant 3 |
CNY 3080.00 |
|
| TP304196 | Recombinant protein of human mitogen-activated protein kinase 3 (MAPK3), transcript variant 1, 20 µg |
CNY 2900.00 |


