Prostaglandin dehydrogenase 1 (HPGD) (NM_000860) Human Mass Spec Standard
CAT#: PH304160
HPGD MS Standard C13 and N15-labeled recombinant protein (NP_000851)
View other "Prostaglandin dehydrogenase 1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | HPGD MS Standard C13 and N15-labeled recombinant protein (NP_000851) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204160 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC204160 protein sequence
Red=Cloning site Green=Tags(s) MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000851 |
RefSeq Size | 3044 |
RefSeq ORF | 798 |
Synonyms | 15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1 |
Locus ID | 3248 |
Cytogenetics | 4q34.1 |
Summary | This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400305 | HPGD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429019 | HPGD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400305 | Transient overexpression lysate of hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1 |
CNY 3080.00 |
|
LY429019 | Transient overexpression lysate of hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 2 |
CNY 3080.00 |
|
TP304160 | Recombinant protein of human hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Prostaglandin dehydrogenase 1产品