EFEMP1 (NM_001039349) Human Mass Spec Standard
CAT#: PH304090
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438)
View other "EFEMP1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204090 |
| Predicted MW | 54.6 kDa |
| Protein Sequence |
>RC204090 protein sequence
Red=Cloning site Green=Tags(s) MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC LPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIR RNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGE QCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCN QGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVLRLTIIVGP FSF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034438 |
| RefSeq Size | 3053 |
| RefSeq ORF | 1479 |
| Synonyms | DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5 |
| Locus ID | 2202 |
| Cytogenetics | 2p16.1 |
| Summary | This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418212 | EFEMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418212 | Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1 |
CNY 3080.00 |
|
| PH314953 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004096) |
CNY 19520.00 |
|
| PH316753 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034437) |
CNY 14250.00 |
|
| TP304090 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP314953 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316753 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 20 µg |
CNY 2900.00 |


